DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Elane

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_056594.2 Gene:Elane / 50701 MGIID:2679229 Length:265 Species:Mus musculus


Alignment Length:262 Identity:71/262 - (27%)
Similarity:110/262 - (41%) Gaps:36/262 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NKVILRILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDA 66
            ::.:..:|..|||.|....|     .||||.....:...::..|:||.      ...||..::..
Mouse     8 SRTLAAMLLALFLGGPALAS-----EIVGGRPARPHAWPFMASLQRRG------GHFCGATLIAR 61

  Fly    67 VTIATAAHCVYNREAENFLVVAG--DDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPP 129
            ..:.:|||||......:..||.|  |..|.........|.::..:. ::.|.:.|||.::     
Mouse    62 NFVMSAAHCVNGLNFRSVQVVLGAHDLRRQERTRQTFSVQRIFENG-FDPSQLLNDIVII----- 120

  Fly   130 LPLDSFSTMEAIEIASEQPAVG------VQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEA 188
             .|:..:|:.|....::.||.|      ......|||....|..|...||::.|.:| :..|:  
Mouse   121 -QLNGSATINANVQVAQLPAQGQGVGDRTPCLAMGWGRLGTNRPSPSVLQELNVTVV-TNMCR-- 181

  Fly   189 YYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSW-GEGCARPNYPGVYANVAYYKD 252
               |.::   :|..:.......|.||||||||..|.:.||.|: ..||....||..:|.||.:.|
Mouse   182 ---RRVN---VCTLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGLYPDAFAPVAEFAD 240

  Fly   253 WI 254
            ||
Mouse   241 WI 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 63/235 (27%)
Tryp_SPc 28..257 CDD:238113 65/236 (28%)
ElaneNP_056594.2 Tryp_SPc 28..242 CDD:214473 63/235 (27%)
Tryp_SPc 29..245 CDD:238113 65/236 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.