DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Prss53

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_006230384.1 Gene:Prss53 / 499270 RGDID:1566127 Length:591 Species:Rattus norvegicus


Alignment Length:211 Identity:59/211 - (27%)
Similarity:94/211 - (44%) Gaps:29/211 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CGGCILDAVTIATAAHCVYNREA-ENFLV--VAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDND 120
            |||.::..|.:.|||||...|:. |.:.|  .||.:..|        :.:||.|..|......:|
  Rat   365 CGGALVSEVVVLTAAHCFIGRQTLEEWSVGLGAGPEEWG--------LKQLILHGAYTHPEGGHD 421

  Fly   121 IALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGW--GYTKENGLSSDQLQQVKVPIVDSE 183
            :|.:::..|:.|........:..|..:...|..    ||  |.|:|.|::..  ..|.|.::...
  Rat   422 VAFLLLAQPVTLGPGLRPLCLPYADHRLPDGEH----GWVLGLTREAGINHP--HTVPVTVLGPM 480

  Fly   184 KCQEAYYWR-----PISEGMLCAGLSEGGKDACQGDSGGPLVVANK----LAGIVSWGEGCARPN 239
            .|...:...     ||..||:|..: .|....|:|.||.|||...:    |||:.|:|:.|....
  Rat   481 ACSRQHAASGSTGVPILPGMICTTV-VGEPPHCEGLSGAPLVHEIRGTWFLAGLHSFGDTCQGSA 544

  Fly   240 YPGVYANVAYYKDWIA 255
            .|.|:|.::.|:||::
  Rat   545 KPAVFAALSAYEDWVS 560

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 58/208 (28%)
Tryp_SPc 28..257 CDD:238113 59/211 (28%)
Prss53XP_006230384.1 Tryp_SPc 45..310 CDD:238113
Tryp_SPc 341..561 CDD:238113 59/211 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24276
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.