DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and prss2

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001011202.1 Gene:prss2 / 496627 XenbaseID:XB-GENE-6065254 Length:243 Species:Xenopus tropicalis


Alignment Length:260 Identity:98/260 - (37%)
Similarity:138/260 - (53%) Gaps:35/260 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIA 70
            :::|.:..|||  |.:|..|.:|:||:..:.....|:|.|      :|.| ..|||.::....:.
 Frog     1 MKLLLICVLLG--AAAAFDDDKIIGGSTCARNSVPYIVSL------NSGY-HFCGGSLISNQWVV 56

  Fly    71 TAAHC----VYNREAE-NFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPL 130
            :||||    |..|..| |..:..|.:.       .:..:|:|.|..|||.|:||||.|:.:..|.
 Frog    57 SAAHCYKASVQVRLGEHNIALSEGTEQ-------FINSAKVIRHPSYNSRTIDNDIMLIKLASPA 114

  Fly   131 PLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSS------DQLQQVKVPIVDSEKCQEAY 189
            .|:  |.:..:.:.|...|.|....:||||     .||:      |.||.:..||:.:.:|..||
 Frog   115 SLN--SAVNTVALPSSCAAAGTSCLVSGWG-----NLSTTTSNYPDLLQCLNAPILTTAQCSGAY 172

  Fly   190 YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            ..: |:..|.|||..|||||:||||||||:|...:|.|:||||.|||:.|||||||.|..|..||
 Frog   173 PGQ-ITNNMFCAGFLEGGKDSCQGDSGGPVVCNGELQGVVSWGIGCAQRNYPGVYAKVCNYNSWI 236

  Fly   255  254
             Frog   237  236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 89/237 (38%)
Tryp_SPc 28..257 CDD:238113 91/238 (38%)
prss2NP_001011202.1 Tryp_SPc 21..239 CDD:238113 91/238 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.