DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and epsilonTry

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_525112.1 Gene:epsilonTry / 49080 FlyBaseID:FBgn0010425 Length:256 Species:Drosophila melanogaster


Alignment Length:264 Identity:111/264 - (42%)
Similarity:146/264 - (55%) Gaps:23/264 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VILRILAVLFLLGIY--AVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDA 66
            |:|.:||.. |.|..  .:..|.|||||||.:||.....|.|.|:|..|      ..|||.|...
  Fly     6 VLLSVLACA-LAGTIPDGLLPQLDGRIVGGYETSIDAHPYQVSLQRYGS------HFCGGSIYSH 63

  Fly    67 VTIATAAHCVYNREAENFLVVAGDDS-RGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPL 130
            ..:.|||||:.:.||::..:..|... |.|  |.|..|.....||.|||.||.||||::.::..|
  Fly    64 DIVITAAHCLQSIEAKDLKIRVGSTYWRSG--GSVHSVRSFRNHEGYNSRTMVNDIAIIRIESDL 126

  Fly   131 PLDSF-STMEAIEIASEQPAVGVQATISGWGYTKENGLS-SDQLQQVKVPIVDSEKCQ--EAYYW 191
               || |::..|.||...|..|..|.:||||.|:..|.: .|.|..|.:.|:|..:|:  |..|.
  Fly   127 ---SFRSSIREIRIADSNPREGATAVVSGWGTTESGGSTIPDHLLAVDLEIIDVSRCRSDEFGYG 188

  Fly   192 RPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWIAK 256
            :.|.:.||||....  |||||||||||||..::|.|:||||.||....||||||:||::.:||  
  Fly   189 KKIKDTMLCAYAPH--KDACQGDSGGPLVSGDRLVGVVSWGYGCGDVRYPGVYADVAHFHEWI-- 249

  Fly   257 QRTS 260
            :||:
  Fly   250 ERTA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 98/231 (42%)
Tryp_SPc 28..257 CDD:238113 99/233 (42%)
epsilonTryNP_525112.1 Tryp_SPc 30..249 CDD:214473 98/231 (42%)
Tryp_SPc 31..252 CDD:238113 99/235 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.