DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and alphaTry

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_476771.1 Gene:alphaTry / 48316 FlyBaseID:FBgn0003863 Length:256 Species:Drosophila melanogaster


Alignment Length:270 Identity:118/270 - (43%)
Similarity:152/270 - (56%) Gaps:25/270 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNKVILRILAVLFLLG---IYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGC 62
            |.|:::.:.||:..||   ...:..|.|||||||:.|:.....:.:.|:|..|.|      |||.
  Fly     1 MLKIVILLSAVVCALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHS------CGGS 59

  Fly    63 ILDAVTIATAAHCVYNREAENFLVVAGDD--SRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVV 125
            |..|..|.|||||:.:..|....|.||..  |.|   |||.:||....||.||::||.||||::.
  Fly    60 IYSANIIVTAAHCLQSVSASVLQVRAGSTYWSSG---GVVAKVSSFKNHEGYNANTMVNDIAVIR 121

  Fly   126 VDPPLPLDSF-STMEAIEIASEQPAVGVQATISGWGYTKENGLSS--DQLQQVKVPIVDSEKCQE 187
            :...|   || |:::||.:|:..||.|..|.:|||| |:.:|.||  .|||.|.|.||...:|..
  Fly   122 LSSSL---SFSSSIKAISLATYNPANGASAAVSGWG-TQSSGSSSIPSQLQYVNVNIVSQSQCAS 182

  Fly   188 AY--YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYY 250
            :.  |...|...|:||..|  ||||||||||||||....|.|:||||.|||..|||||||:||..
  Fly   183 STYGYGSQIRNTMICAAAS--GKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAVL 245

  Fly   251 KDWIAKQRTS 260
            :.|:.....|
  Fly   246 RSWVVSTANS 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 107/233 (46%)
Tryp_SPc 28..257 CDD:238113 107/235 (46%)
alphaTryNP_476771.1 Tryp_SPc 30..249 CDD:214473 107/233 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.