DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and KLK12

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_062544.1 Gene:KLK12 / 43849 HGNCID:6360 Length:254 Species:Homo sapiens


Alignment Length:244 Identity:73/244 - (29%)
Similarity:116/244 - (47%) Gaps:17/244 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAA 73
            |::..||.:..:|..:..:|..|.:.......:.|.|...:|      ..|||.::|...:.|||
Human     3 LSIFLLLCVLGLSQAATPKIFNGTECGRNSQPWQVGLFEGTS------LRCGGVLIDHRWVLTAA 61

  Fly    74 HCVYNREAENFLVVAGDDSRGGMNGV-VVRVSKL-IPHELYNSSTMDNDIALVVVDPPLPLDSFS 136
            ||..:|    :.|..|:.|...::.. .:|.|.. :.|..|..::..::..|.::...||:...|
Human    62 HCSGSR----YWVRLGEHSLSQLDWTEQIRHSGFSVTHPGYLGASTSHEHDLRLLRLRLPVRVTS 122

  Fly   137 TMEAIEIASEQPAVGVQATISGWGYTKE-NGLSSDQLQQVKVPIVDSEKCQEAYYWRPISEGMLC 200
            :::.:.:.::....|.:..:||||.|.. .....|.||.:.:.||....|...|..| |:..|:|
Human   123 SVQPLPLPNDCATAGTECHVSGWGITNHPRNPFPDLLQCLNLSIVSHATCHGVYPGR-ITSNMVC 186

  Fly   201 AGLSEGGKDACQGDSGGPLVVANKLAGIVSWGE--GCARPNYPGVYANV 247
            || ...|:||||||||||||....|.|:||||.  .|.:...||||..:
Human   187 AG-GVPGQDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQDGIPGVYTYI 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 69/226 (31%)
Tryp_SPc 28..257 CDD:238113 69/225 (31%)
KLK12NP_062544.1 Tryp_SPc 21..236 CDD:214473 69/226 (31%)
Tryp_SPc 22..236 CDD:238113 69/225 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.