DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Gm5771

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001034086.1 Gene:Gm5771 / 436523 MGIID:3646222 Length:245 Species:Mus musculus


Alignment Length:253 Identity:95/253 - (37%)
Similarity:130/253 - (51%) Gaps:25/253 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVLF--LLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATA 72
            |:||  |:|........|.:||||.........|.|.|      :|.| ..|||.:::...:.:|
Mouse     3 ALLFLALVGAAVAFPVDDDKIVGGYTCRENSVPYQVSL------NSGY-HFCGGSLINDQWVVSA 60

  Fly    73 AHCVYNR-----EAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPL 132
            |||...|     ...|..|:.|::.       .|..:|:|.|..:|..|::|||.|:.:..|:.|
Mouse    61 AHCYKTRIQVRLGEHNIKVLEGNEQ-------FVNAAKIIKHPNFNRKTLNNDIMLIKLSSPVTL 118

  Fly   133 DSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSS-DQLQQVKVPIVDSEKCQEAYYWRPISE 196
            :  :.:..:.:.|.....|.|..|||||.|...|:|. |.||.:..|::....| ||.|...|:.
Mouse   119 N--ARVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADC-EASYPGKITG 180

  Fly   197 GMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            .|:|||..|||||:||||||||:|...:|.||||||.|||..:.||||..|..|.|||
Mouse   181 NMVCAGFLEGGKDSCQGDSGGPVVCNGELQGIVSWGYGCALADNPGVYTKVCNYVDWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 87/232 (38%)
Tryp_SPc 28..257 CDD:238113 89/233 (38%)
Gm5771NP_001034086.1 Tryp_SPc 22..238 CDD:214473 87/232 (38%)
Tryp_SPc 23..241 CDD:238113 89/233 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.