DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Tmprss11c

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001025468.1 Gene:Tmprss11c / 435845 MGIID:3521861 Length:431 Species:Mus musculus


Alignment Length:245 Identity:86/245 - (35%)
Similarity:121/245 - (49%) Gaps:29/245 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYNREAE--------N 83
            ::.||.|.......:...|::.|      ...||..::....:.||||| :.|.|.        .
Mouse   199 KVAGGQDAEEGEWPWQASLQQNS------VHRCGATLISNYWLITAAHC-FIRAANPKDWKVSFG 256

  Fly    84 FLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQP 148
            ||:......|.        |..:|.||.|:....|||||:|.:..|:..:|......:..|:::.
Mouse   257 FLLSKPQAPRA--------VKNIIIHENYSYPAHDNDIAVVRLSSPVLYESNIRRACLPEATQKF 313

  Fly   149 AVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEA-YYWRPISEGMLCAGLSEGGKDACQ 212
            .......::|||..|.:|.|.:.||:.||.|:|::.|... .|...|:.||:|||..:|..||||
Mouse   314 PPNSDVVVTGWGTLKSDGDSPNILQKGKVKIIDNKTCNSGKAYGGMITPGMMCAGFLKGRVDACQ 378

  Fly   213 GDSGGPLVVANK-----LAGIVSWGEGCARPNYPGVYANVAYYKDWIAKQ 257
            ||||||||..:.     ||||||||:.||.||.||||..|.||:|||..:
Mouse   379 GDSGGPLVSEDSKGIWFLAGIVSWGDECALPNKPGVYTRVTYYRDWITSK 428

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 84/240 (35%)
Tryp_SPc 28..257 CDD:238113 86/242 (36%)
Tmprss11cNP_001025468.1 SEA 62..157 CDD:279699
Tryp_SPc 199..425 CDD:214473 84/240 (35%)
Tryp_SPc 200..428 CDD:238113 86/242 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5783
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.860

Return to query results.
Submit another query.