DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and intr

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_651633.1 Gene:intr / 43397 FlyBaseID:FBgn0039599 Length:298 Species:Drosophila melanogaster


Alignment Length:209 Identity:45/209 - (21%)
Similarity:82/209 - (39%) Gaps:59/209 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CGGCILDAVTIATAAHCV-----------YNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELY 112
            |.|.::....:.|:|.|.           |..:|..        ||      :..|:.||...: 
  Fly   113 CSGALISTRLVLTSALCFPRTLRQPPPRSYKLQASR--------SR------IYSVANLITGAI- 162

  Fly   113 NSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENG-----LSSDQL 172
                  .|:||:::..||. |.|  :..|::. |.|             .:.|.     :|...|
  Fly   163 ------EDMALLLLHAPLE-DPF--VHPIDLC-ESP-------------LRRNDNVTMYMSQQHL 204

  Fly   173 QQVKVPIVDSEKCQEAYYWRP---ISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEG 234
            :.::..::.:..|:.:|....   |::.|||| |:......||...|..|:..::|.|:..:|:.
  Fly   205 RFLRTKLIPNSNCKRSYAQDENAFITQTMLCA-LNSNRLVDCQTAKGDVLLHQDRLCGVDIYGQH 268

  Fly   235 CARPNYPG-VYANV 247
            |:.....| :||:|
  Fly   269 CSDGGVNGELYADV 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 45/209 (22%)
Tryp_SPc 28..257 CDD:238113 45/209 (22%)
intrNP_651633.1 Tryp_SPc 112..284 CDD:304450 45/209 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.