DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG15498

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650974.1 Gene:CG15498 / 42548 FlyBaseID:FBgn0038892 Length:281 Species:Drosophila melanogaster


Alignment Length:194 Identity:38/194 - (19%)
Similarity:63/194 - (32%) Gaps:75/194 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 QLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRV----- 103
            ::::|..|        |..:||      ....||:|..:.  .|.|........||||::     
  Fly    24 EMKKRRES--------GNLLLD------RTRAVYDRFYQG--TVLGPPQDVLAFGVVVQIRPVKI 72

  Fly   104 --------------SKLIPHE-LY-NSSTMDNDIALVVVDPPLPL--DSFS-------------- 136
                          |.:|..| |: |..|::....|.|...|.|.  :||.              
  Fly    73 GVCRQQVSDQNLVLSVVITQEGLHRNCKTINEMCDLTVAPSPRPALRNSFRIVSPNEDDRTGQYL 137

  Fly   137 ------TMEAIEIASEQPAV-------GVQATISGWGYTKENGLSSDQLQQVKVP--IVDSEKC 185
                  .::|:|.|.|...|       .:...:....:|.:||       :|.:|  :|..:.|
  Fly   138 AYGEKFRLQALEPADEPMYVFSGPKRLNLSLPVEKAFFTTKNG-------EVTLPLGLVSHKNC 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 38/194 (20%)
Tryp_SPc 28..257 CDD:238113 38/194 (20%)
CG15498NP_650974.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.