DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG7142

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650703.1 Gene:CG7142 / 42194 FlyBaseID:FBgn0038595 Length:334 Species:Drosophila melanogaster


Alignment Length:284 Identity:82/284 - (28%)
Similarity:124/284 - (43%) Gaps:57/284 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 GRIVGGADT----------------------SSYYTKYVVQLRRRSSSSSSYAQT---------- 58
            ||..|.|.|                      .:::||..:..|..:..|:.|..:          
  Fly    42 GRSAGAAHTMAMNLAAYGLLENRISTLEAPRQTHWTKKFLAKREATPHSAPYVVSIQMMTPDQGL 106

  Fly    59 ---CGGCILDAVTIATAAHCVYNREA-ENFLVVAGD----DSRGGMNGVVVR-VSKLIPHELYNS 114
               |.|.|::...|.|||||:.:.:| ||.::|||.    |.:|..:.:.:| :...:.||||..
  Fly   107 VHYCAGTIINEHWILTAAHCLSSPQAVENSVIVAGSHDIHDQKGEASNIQMRHIDYYVRHELYLG 171

  Fly   115 STMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSS--DQLQQVKV 177
            .....||||:....||..|::.....:.....||.  ...|:.|||......:.:  .:||:..:
  Fly   172 GVNPYDIALIYTKEPLVFDTYVQPATLPEQDAQPE--GYGTLYGWGNVSMTAVPNYPHRLQEANM 234

  Fly   178 PIVDSEKCQE--AYYWRPISEGMLCAGLSEGGKDACQGDSGGPLV---------VANKLAGIVSW 231
            ||:|.|.|::  |....|:.|..||.|...||...|..||||||:         .||.:.|||||
  Fly   235 PILDMELCEQILARSGLPLHETNLCTGPLTGGVSICTADSGGPLIQQCCEEHFEQANIVIGIVSW 299

  Fly   232 GE-GCARPNYPGVYANVAYYKDWI 254
            |: .|.:.|.|.|:..|:.:.:||
  Fly   300 GKMPCGQKNAPSVFVRVSAFTEWI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 79/281 (28%)
Tryp_SPc 28..257 CDD:238113 80/282 (28%)
CG7142NP_650703.1 Tryp_SPc 84..326 CDD:238113 75/242 (31%)
Tryp_SPc 84..323 CDD:214473 73/240 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455601
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.