DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG5255

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650604.1 Gene:CG5255 / 42073 FlyBaseID:FBgn0038485 Length:273 Species:Drosophila melanogaster


Alignment Length:257 Identity:80/257 - (31%)
Similarity:126/257 - (49%) Gaps:18/257 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILAVLFLLGIYAVSAQSD---------GRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCI 63
            :|.:|..|.::..||.|.         .|||||.:.::....|.:.|:    ...|.|.:|||.|
  Fly     1 MLLILLPLVLFTSSAASQILYPPQYTKNRIVGGEEAAAGLAPYQISLQ----GIGSGAHSCGGAI 61

  Fly    64 LDAVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDP 128
            :|...|.|||||...|:|..|.|:.|...............:::.|..|......|||||:.::.
  Fly    62 IDERWIITAAHCTRGRQATAFRVLTGTQDLHQNGSKYYYPDRIVEHSNYAPRKYRNDIALLHLNE 126

  Fly   129 PLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAY-YWR 192
            .:..|  :..:.:|:..|....|.:..::|||.....|....:||.::|..|..|:|:.|: ...
  Fly   127 SIVFD--NATQPVELDHEALVPGSRLLLTGWGTLSLGGDVPARLQSLEVNYVPFEQCRAAHDNST 189

  Fly   193 PISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            .:..|.:|. .::.|:.||.||||||||...||..:|:||..||: .||..:|:::||.|:|
  Fly   190 RVDIGHVCT-FNDKGRGACHGDSGGPLVHNGKLVALVNWGLPCAK-GYPDAHASISYYHDFI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 73/227 (32%)
Tryp_SPc 28..257 CDD:238113 73/228 (32%)
CG5255NP_650604.1 Tryp_SPc 29..249 CDD:214473 73/227 (32%)
Tryp_SPc 30..252 CDD:238113 73/228 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.