DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG5246

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_650603.1 Gene:CG5246 / 42072 FlyBaseID:FBgn0038484 Length:272 Species:Drosophila melanogaster


Alignment Length:277 Identity:92/277 - (33%)
Similarity:141/277 - (50%) Gaps:36/277 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VILRILAVLFLLGIYAVS-------------AQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSY 55
            |::.:|.:|......:|.             .:.:.|::||.|:.:.:..|.|.:......    
  Fly     5 VLISVLVILSQCSAKSVKIHRRHQLNHHLGHVKPETRVIGGVDSPTGFAPYQVSIMNTFGE---- 65

  Fly    56 AQTCGGCILDAVTIATAAHCVYNREAENFLVVAG--DDSRGGMNGVVVRVSKLIPHELYNSSTMD 118
             ..|||.|:....|.|||||: ....:...:|.|  |.:|.|.. .:|..||:  |..::.....
  Fly    66 -HVCGGSIIAPQWILTAAHCM-EWPIQYLKIVTGTVDYTRPGAE-YLVDGSKI--HCSHDKPAYH 125

  Fly   119 NDIALVVVDPPLPLDSFSTMEAIEIASE--QPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVD 181
            |||||:....|:..|..:  :.|::||:  .|.||.:.|::|||.||..|..|.|||::.:..:|
  Fly   126 NDIALIHTAKPIVYDDLT--QPIKLASKGSLPKVGDKLTLTGWGSTKTWGRYSTQLQKIDLNYID 188

  Fly   182 SEKCQEAY---YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANK-LAGIVSWGEGCARPNYPG 242
            .:.||...   .|  :|||.:|. .::.|:.:|.||||||||.||: |.|:|:|||.|| ..||.
  Fly   189 HDNCQSRVRNANW--LSEGHVCT-FTQEGEGSCHGDSGGPLVDANQTLVGVVNWGEACA-IGYPD 249

  Fly   243 VYANVAYYKDWIAKQRT 259
            |:.:||||.|||.:..|
  Fly   250 VFGSVAYYHDWIEQMMT 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 85/234 (36%)
Tryp_SPc 28..257 CDD:238113 86/236 (36%)
CG5246NP_650603.1 Tryp_SPc 41..261 CDD:214473 85/234 (36%)
Tryp_SPc 42..263 CDD:238113 86/235 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.930

Return to query results.
Submit another query.