DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG10587

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001137989.2 Gene:CG10587 / 40318 FlyBaseID:FBgn0037039 Length:289 Species:Drosophila melanogaster


Alignment Length:244 Identity:76/244 - (31%)
Similarity:124/244 - (50%) Gaps:26/244 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGG-ADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYNREAENFLVVAGD 90
            |:||| ..|::....|::.||...:.      .|||.:|..:.:.|||||...|...:..:..|.
  Fly    45 RVVGGDVTTNAQLGGYLIALRYEMNF------VCGGTLLHDLIVLTAAHCFLGRVKISDWLAVGG 103

  Fly    91 DSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQAT 155
            .|:....|:..:|.::|....:....|:.|:|::.:..|:   ...::..:.:..:|...|.:..
  Fly   104 ASKLNDRGIQRQVKEVIKSAEFREDDMNMDVAILRLKKPM---KGKSLGQLILCKKQLMPGTELR 165

  Fly   156 ISGWGYTKENGLSSDQ-LQQVKVPIVDSEKCQEAYY---WRP-----------ISEGMLCAGLSE 205
            :||||.|:.:.....: |:.|.||:||.:||:.:|.   |..           :::.|.|||:. 
  Fly   166 VSGWGLTENSEFGPQKLLRTVTVPVVDKKKCRASYLPTDWESHKHFDLFLKVHLTDSMFCAGVL- 229

  Fly   206 GGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            |.||||..|||||||..|::.||||:|.|||...|.|||.::.|.|.:|
  Fly   230 GKKDACTFDSGGPLVYKNQVCGIVSFGIGCASKRYYGVYTDIMYVKPFI 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 75/242 (31%)
Tryp_SPc 28..257 CDD:238113 75/243 (31%)
CG10587NP_001137989.2 Tryp_SPc 45..278 CDD:214473 75/242 (31%)
Tryp_SPc 46..280 CDD:238113 75/243 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.