DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Sems

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_649270.1 Gene:Sems / 40315 FlyBaseID:FBgn0037036 Length:275 Species:Drosophila melanogaster


Alignment Length:260 Identity:88/260 - (33%)
Similarity:133/260 - (51%) Gaps:22/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 NKVI-LRILAVLFLLGIYAVSAQSDGRIVGG-ADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCIL 64
            |:.| |:.||.:.|...|..      |::|| ..|::....|:|.:|..::.      .|||.::
  Fly    23 NETIDLKKLAKIVLPPAYQT------RVIGGRVTTNAKLGGYLVAMRYFNNF------ICGGTLI 75

  Fly    65 DAVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPP 129
            ..:.:.|||||..:|..:....|.|..||....|:..:|.:.|....:...||:.|:|:|:::.|
  Fly    76 HELIVLTAAHCFEDRAEKEAWSVDGGISRLSEKGIRRQVKRFIKSAQFKMVTMNMDVAVVLLNRP 140

  Fly   130 LPLDSFSTMEAIEIASEQPAVGVQATISGWGYTK--ENGLSSDQLQQVKVPIVDSEKCQEAYYWR 192
            :...:..|   :.:.|.....|....:||||.|.  :.| ....|:.|.||:::...|:|||...
  Fly   141 MVGKNIGT---LSLCSTALTPGQTMDVSGWGMTNPDDEG-PGHMLRTVSVPVIEKRICREAYRES 201

  Fly   193 -PISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWIAK 256
             .||:.|.||.:. |.||||..|||||||...::.||||:|.|||...|||||.:|.|.|.:|.|
  Fly   202 VSISDSMFCASVL-GKKDACTYDSGGPLVYEKQVCGIVSFGIGCASRRYPGVYTDVHYVKPFIVK 265

  Fly   257  256
              Fly   266  265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 79/230 (34%)
Tryp_SPc 28..257 CDD:238113 80/233 (34%)
SemsNP_649270.1 Tryp_SPc 43..263 CDD:214473 79/230 (34%)
Tryp_SPc 44..265 CDD:238113 79/231 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455673
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.