DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG10663

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001097592.1 Gene:CG10663 / 39421 FlyBaseID:FBgn0036287 Length:748 Species:Drosophila melanogaster


Alignment Length:239 Identity:69/239 - (28%)
Similarity:114/239 - (47%) Gaps:20/239 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYNREAENFLVVAGDD 91
            :|:||.........:.|.:..|...:     .|||.::....:.||||||    .:...|..|:.
  Fly   506 KIIGGRAARKGEWPWQVAILNRFKEA-----FCGGTLIAPRWVLTAAHCV----RKVLFVRIGEH 561

  Fly    92 SRGGMNG--VVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQA 154
            :....:|  :.:||.|...|..::..|:|:|:||:.:...:...::.....:....:.....|..
  Fly   562 NLNYEDGTEIQLRVMKSYTHPNFDKRTVDSDVALLRLPKAVNATTWIGYSCLPQPFQALPKNVDC 626

  Fly   155 TISGWGYTK-ENGLSSDQLQQVKVPIVDSEKCQEAYYWRPISEGMLCAGLSEGGKDACQGDSGGP 218
            ||.|||..: .:...:..|.:..|||:..:.|::.||...|::.|.|||..:|..|.|.||||||
  Fly   627 TIIGWGKRRNRDATGTSVLHKATVPIIPMQNCRKVYYDYTITKNMFCAGHQKGHIDTCAGDSGGP 691

  Fly   219 LVVAN--------KLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            |:..:        .:.||.|:|:|||:.|..|:||.|..|.||:
  Fly   692 LLCRDTTKPNHPWTIFGITSFGDGCAQRNKFGIYAKVPNYVDWV 735

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 68/237 (29%)
Tryp_SPc 28..257 CDD:238113 69/238 (29%)
CG10663NP_001097592.1 Tryp_SPc 506..735 CDD:214473 68/237 (29%)
Tryp_SPc 507..735 CDD:238113 68/236 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455718
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.