DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG9897

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001286753.2 Gene:CG9897 / 37651 FlyBaseID:FBgn0034807 Length:265 Species:Drosophila melanogaster


Alignment Length:277 Identity:82/277 - (29%)
Similarity:122/277 - (44%) Gaps:48/277 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILAVLFLLGIYAVS--AQSDGRIVGG----ADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDA 66
            :||.|.||.|.|:.  |..|.||:.|    ...:.:|...:|..:.:          |||.|:..
  Fly     1 MLAPLILLQIVALPWLALGDQRIINGNTVNIKDAPWYASIIVNSKLK----------CGGAIISK 55

  Fly    67 VTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLP 131
            ..|.|||.||....|.:..|..|..| .|.:|.:..:.|:..|..|:|...||::||:....  .
  Fly    56 NYILTAAKCVDGYSARSIQVRLGTSS-CGTSGSIAGICKVKVHSQYSSWRFDNNLALLKTCE--L 117

  Fly   132 LDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGL--------SSD----------QLQQVKVP 178
            |::...::.||.|.:.|....:|.::|.|....|.|        ||.          ||...:|.
  Fly   118 LNTTDEIKPIERADKVPDDNSRANVTGCGGRSGNFLDLILDLRISSGIEEKCFQLPVQLHGTQVR 182

  Fly   179 IVDSEKCQ------EAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCAR 237
            |:..::|.      ..|..:.||:..:|.  ...||.||..|.|.|||:.|||.||:| ..||:.
  Fly   183 ILSQKQCAADWKVIPFYLLKGISDLTICT--KSPGKGACSTDRGSPLVIDNKLVGILS-RAGCSI 244

  Fly   238 PNYPGVYANVAYYKDWI 254
            .  |.||||:..:.:|:
  Fly   245 K--PDVYANILGHTNWL 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 72/254 (28%)
Tryp_SPc 28..257 CDD:238113 72/255 (28%)
CG9897NP_001286753.2 Tryp_SPc 22..258 CDD:214473 72/253 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.