DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG32833

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_726278.1 Gene:CG32833 / 37650 FlyBaseID:FBgn0052833 Length:268 Species:Drosophila melanogaster


Alignment Length:279 Identity:73/279 - (26%)
Similarity:125/279 - (44%) Gaps:51/279 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRILAVLFLLGIYAVSAQSDGR----------IVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCG 60
            |.|...||:|......|..|..          .:||...:.....::      :|.|......|.
  Fly     6 LPIFLALFVLSKSDTGAGEDSEEDDENDCNRTTLGGHPVNITTAPWI------ASISIKQKAKCD 64

  Fly    61 GCILDAVTIATAAHCVYNREAENFL-----VVAGDDSRGGMNGVV-VRVSKLIPHELYNSSTMDN 119
            |.|.....|.||..||     :.||     |..|..:|.  :||: |.|..:..||.:...|:.:
  Fly    65 GAIYKLSHIVTAGKCV-----DGFLNKVIRVRVGSTTRS--DGVIEVAVCNITVHEKFTGQTVFH 122

  Fly   120 DIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWG-------YTKENGLSSD--QLQQV 175
            ::|::.:..  ||::..|::.|::|::.|:.|.:.|.:||.       |.|: .|..:  :||:.
  Fly   123 NVAILKLCE--PLEASKTIQPIQLANQLPSNGAKVTANGWPSFRWWAMYWKK-CLDDEAYKLQKA 184

  Fly   176 KVPIVDSEKCQEAY---YW--RPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGC 235
            :|.::...:|.:.:   .|  :..::.:.|.  .:..|:||....|.|:|...||.||::.| ||
  Fly   185 EVKLLGPSQCTDLWARNNWSKKNFTDDLFCT--EKFAKEACSLAMGSPVVHNGKLVGIITKG-GC 246

  Fly   236 ARPNYPGVYANVAYYKDWI 254
            :  .||.||.|:..||||:
  Fly   247 S--EYPEVYINLIKYKDWL 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 65/256 (25%)
Tryp_SPc 28..257 CDD:238113 66/247 (27%)
CG32833NP_726278.1 Tryp_SPc 40..266 CDD:238113 66/245 (27%)
Tryp_SPc 40..262 CDD:214473 64/242 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.