DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Ser8

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_610874.1 Gene:Ser8 / 36489 FlyBaseID:FBgn0019928 Length:260 Species:Drosophila melanogaster


Alignment Length:270 Identity:109/270 - (40%)
Similarity:146/270 - (54%) Gaps:22/270 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNKVILRILAVLFL-------LGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQT 58
            |:.:|...||:|.|       :|:...::...||||||..:|.....:.|.|:|..|      ..
  Fly     1 MSLLIATFLALLALTNGAVIPIGLEPQTSSLGGRIVGGTASSIEDRPWQVSLQRSGS------HF 59

  Fly    59 CGGCILDAVTIATAAHCVYN-REAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIA 122
            |||.|:....|.|||||:.. ....|..:.||.:.| ...||:|.|:.:..||.|||::..|||.
  Fly    60 CGGSIISNNIIVTAAHCLDTPTTVSNLRIRAGSNKR-TYGGVLVEVAAIKAHEAYNSNSKINDIG 123

  Fly   123 LVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQE 187
            :|.:...|...  ||::||.:||..||.|..|:|||||.|..:|.||..|..|...||...:|..
  Fly   124 VVRLKTKLTFG--STIKAITMASATPAHGSAASISGWGKTSTDGPSSATLLFVDTRIVGRSQCGS 186

  Fly   188 AYYWRP--ISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYY 250
            :.|...  |...|:||..:  .|||||||||||||...:|.|:||||..||..||||||||:|..
  Fly   187 STYGYGSFIKATMICAAAT--NKDACQGDSGGPLVSGGQLVGVVSWGRDCAVANYPGVYANIAEL 249

  Fly   251 KDWIAK-QRT 259
            :||:.: |:|
  Fly   250 RDWVLQAQKT 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 98/229 (43%)
Tryp_SPc 28..257 CDD:238113 98/232 (42%)
Ser8NP_610874.1 Tryp_SPc 34..253 CDD:214473 98/229 (43%)
Tryp_SPc 35..253 CDD:238113 97/228 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.