DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and gammaTry

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_725034.1 Gene:gammaTry / 36221 FlyBaseID:FBgn0010359 Length:253 Species:Drosophila melanogaster


Alignment Length:261 Identity:113/261 - (43%)
Similarity:144/261 - (55%) Gaps:19/261 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MNKVILRILAVLFLLG---IYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGC 62
            |.|.::.:.||...||   ...:..|.|||||||:.|:.....:.:.|:|..|.|      |||.
  Fly     1 MLKFVILLSAVACALGGTVPEGLLPQLDGRIVGGSATTISSFPWQISLQRSGSHS------CGGS 59

  Fly    63 ILDAVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVD 127
            |..:..|.|||||:.:..|....:.|| .|.....||...||....||.||::||.||||::.::
  Fly    60 IYSSNVIVTAAHCLQSVSASVLQIRAG-SSYWSSGGVTFSVSSFKNHEGYNANTMVNDIAIIKIN 123

  Fly   128 PPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSS--DQLQQVKVPIVDSEKCQEAY- 189
            ..|...  ||::||.:||..||.|..|::|||| |...|.||  .|||.|.|.||...:|..:. 
  Fly   124 GALTFS--STIKAIGLASSNPANGAAASVSGWG-TLSYGSSSIPSQLQYVNVNIVSQSQCASSTY 185

  Fly   190 -YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDW 253
             |...|...|:||..|  ||||||||||||||....|.|:||||.|||..|||||||:||..:.|
  Fly   186 GYGSQIRSTMICAAAS--GKDACQGDSGGPLVSGGVLVGVVSWGYGCAYSNYPGVYADVAALRSW 248

  Fly   254 I 254
            :
  Fly   249 V 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 103/230 (45%)
Tryp_SPc 28..257 CDD:238113 103/231 (45%)
gammaTryNP_725034.1 Tryp_SPc 30..249 CDD:214473 103/230 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.930

Return to query results.
Submit another query.