DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and thetaTry

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_523693.1 Gene:thetaTry / 36218 FlyBaseID:FBgn0011555 Length:262 Species:Drosophila melanogaster


Alignment Length:272 Identity:99/272 - (36%)
Similarity:137/272 - (50%) Gaps:43/272 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RILAVLFLLGIYAVSA-----------QSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCG 60
            |::.:|..|.:.:..|           :.:||||||.||:.....|.|.|:.:|.|     ..||
  Fly     3 RLVVLLVCLAVGSACAGTVGVSNGDPFEREGRIVGGEDTTIGAHPYQVSLQTKSGS-----HFCG 62

  Fly    61 GCILDAVTIATAAHCVYNREAENFLVVAGDD--SRGGMNGVVVRVSKLIPHELYNSSTMDNDIAL 123
            |.:::..|:.|||||:..|:.....|..|..  :.|   |:||.|.:|..:|.|||.||:.|:.:
  Fly    63 GSLINEDTVVTAAHCLVGRKVSKVFVRLGSTLYNEG---GIVVAVRELAYNEDYNSKTMEYDVGI 124

  Fly   124 VVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSS---------DQLQQVKVPI 179
            :.:|.  .:.....:..||:|:|.|..|..|.::|||       |.         ..||:|.|.|
  Fly   125 LKLDE--KVKETENIRYIELATETPPTGTTAVVTGWG-------SKCYFWCMTLPKTLQEVYVNI 180

  Fly   180 VDSEKC--QEAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPG 242
            ||.:.|  .|..|...|.:.|:||  .|..||||||||||||.|.|.|.||||||..||....||
  Fly   181 VDWKTCASDEYKYGEIIYDSMVCA--YEKKKDACQGDSGGPLAVGNTLVGIVSWGYACASNLLPG 243

  Fly   243 VYANVAYYKDWI 254
            ||::|...:.||
  Fly   244 VYSDVPALRKWI 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 92/239 (38%)
Tryp_SPc 28..257 CDD:238113 93/240 (39%)
thetaTryNP_523693.1 Tryp_SPc 34..255 CDD:214473 92/239 (38%)
Tryp_SPc 35..255 CDD:238113 91/238 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.