DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and PRSS41

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001382429.1 Gene:PRSS41 / 360226 HGNCID:30715 Length:334 Species:Homo sapiens


Alignment Length:260 Identity:71/260 - (27%)
Similarity:115/260 - (44%) Gaps:51/260 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGADTS--SYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHC----VYNREAENFLV 86
            :.||.:::  .:..:..::||||        ..|||.:|....:.:||||    .|..|   :.|
Human    71 VAGGVESARGRWPWQASLRLRRR--------HRCGGSLLSRRWVLSAAHCFQKHYYPSE---WTV 124

  Fly    87 VAGD-------------DSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTM 138
            ..|:             .||..:..::|....|        ..:.|||||:.:...:..:::...
Human   125 QLGELTSRPTPWNLRAYSSRYKVQDIIVNPDAL--------GVLRNDIALLRLASSVTYNAYIQP 181

  Fly   139 EAIEIASEQPAVGVQATISGWGYTKENGLSSD---QLQQVKVPIVDSEKCQEAYYWRPIS----- 195
            ..||.::..........::|||....:|....   .|::.:|.|:::.:|...:. :|.|     
Human   182 ICIESSTFNFVHRPDCWVTGWGLISPSGTPLPPPYNLREAQVTILNNTRCNYLFE-QPSSRSMIW 245

  Fly   196 EGMLCAGLSEGGKDACQGDSGGPLVVANK----LAGIVSWGEGCARPNYPGVYANVAYYKDWIAK 256
            :.|.|||..:|..|.|:||||||||....    ..||||||..|.:||.||||.|::.|..||.:
Human   246 DSMFCAGAEDGSVDTCKGDSGGPLVCDKDGLWYQVGIVSWGMDCGQPNRPGVYTNISVYFHWIRR 310

  Fly   257  256
            Human   311  310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 69/256 (27%)
Tryp_SPc 28..257 CDD:238113 71/260 (27%)
PRSS41NP_001382429.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.