DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Send2

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_609708.2 Gene:Send2 / 34836 FlyBaseID:FBgn0264253 Length:239 Species:Drosophila melanogaster


Alignment Length:252 Identity:84/252 - (33%)
Similarity:122/252 - (48%) Gaps:34/252 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILAVLFLLGIYAVSA----QSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVT 68
            |.:.|.||.:.::||    :.:.||:||.........:.|.::|...      ..|||.|..|..
  Fly     3 IQSFLLLLALNSLSAGPVIRPEERIIGGQPIGIEEAPWQVSIQRDGK------HLCGGSIYSADI 61

  Fly    69 IATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLD 133
            |.||||||   :.:.:.|.||...:.. ||.||.|:.:..||     .:.||||:|.:..  ||:
  Fly    62 IITAAHCV---QGQGYQVRAGSALKNS-NGSVVDVAAIRTHE-----GLGNDIAIVRLSK--PLE 115

  Fly   134 SFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAYYWRPISEGM 198
            ..:.::.|.:|...|..|..|.:||||.:.......| ||.|.:.|      |..||........
  Fly   116 FTNQVQPIPLAKTNPPPGSIAFVSGWGSSSYYSHPID-LQGVNLYI------QWPYYCGLTEPSR 173

  Fly   199 LCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWG-EGCARPNYPGVYANVAYYKDWI 254
            :|||  ..|:.||:||||||||...:|.|:||.| :.|   .|..:|.:|.|:::||
  Fly   174 ICAG--SFGRAACKGDSGGPLVFDQQLVGVVSGGTKDC---TYSSIYTSVPYFREWI 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 76/227 (33%)
Tryp_SPc 28..257 CDD:238113 77/228 (34%)
Send2NP_609708.2 Tryp_SPc 26..225 CDD:214473 76/227 (33%)
Tryp_SPc 27..225 CDD:238113 75/226 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.