DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Phae2

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001285871.1 Gene:Phae2 / 34638 FlyBaseID:FBgn0263235 Length:265 Species:Drosophila melanogaster


Alignment Length:275 Identity:88/275 - (32%)
Similarity:125/275 - (45%) Gaps:45/275 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 RILAVLFLLGIYAVSA-------QSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQT--CGGC 62
            |.||.:.||.: .||.       |.:||:|||...::....|:|        |..|..|  |...
  Fly     5 RHLATILLLAV-CVSQGSGLALDQPEGRVVGGKAAAANSAPYIV--------SMQYGGTHYCAAN 60

  Fly    63 ILDAVTIATAAHCVYNR-EAENFLVVAGDDSRGGMNGVVVR--VSKLIPHELYNSSTMDNDIALV 124
            |:::..:.|||||:.|| :.....:|||..:..|......:  ::..:.::||...|:..||.|:
  Fly    61 IINSNWLVTAAHCLANRNQVLGSTLVAGSIAVAGTASTTQKRQITHYVINDLYTGGTVPYDIGLI 125

  Fly   125 VVDPPLPLDSFSTMEAIEIASEQPAVGVQAT----ISGWGYTKENGLSS--DQLQQVK-VPIVDS 182
            ......      |..|.....:.|:.||:.|    :.|||.|.:....|  ..||:.| :||:..
  Fly   126 YTPTAF------TWTAAVAPVKLPSSGVRPTGKADLFGWGSTSKTNSPSYPKTLQEAKNIPIISL 184

  Fly   183 EKCQEAYYWRPISEGM------LCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGE-GCARPNY 240
            :.|..|..    |:|.      ||.|...||...|..|||||||..|.|.||||||: .|.:||.
  Fly   185 DSCAAALG----SKGQDVHTTNLCTGPLTGGTSFCTSDSGGPLVQGNVLIGIVSWGKLPCGQPNS 245

  Fly   241 PGVYANVAYYKDWIA 255
            |.||..|:.:..|||
  Fly   246 PSVYVQVSSFITWIA 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 76/245 (31%)
Tryp_SPc 28..257 CDD:238113 78/247 (32%)
Phae2NP_001285871.1 Tryp_SPc 31..259 CDD:214473 76/245 (31%)
Tryp_SPc 32..262 CDD:238113 78/247 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.