DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and PRSS38

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_898885.1 Gene:PRSS38 / 339501 HGNCID:29625 Length:326 Species:Homo sapiens


Alignment Length:266 Identity:85/266 - (31%)
Similarity:130/266 - (48%) Gaps:47/266 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLGIYAVSAQS-DGRIVGGADTSSYYTKYVVQLRRRSSSSSSYA--QTCGGCILDAVTIATAAHC 75
            |.|..|....| :|:|:||.....  .|:..|:      |..||  ..|||.||:...:.:||||
Human    45 LTGSVACGRPSMEGKILGGVPAPE--RKWPWQV------SVHYAGLHVCGGSILNEYWVLSAAHC 101

  Fly    76 VYNREAENF-----------LVVAGDDSRGGMNGVVVRVSKLIPH---ELYNSSTMDNDIALVVV 126
             ::|: :|.           |.|||:.::.      ..|:::|.|   |:|:  .:..|:|||.:
Human   102 -FHRD-KNIKIYDMYVGLVNLRVAGNHTQW------YEVNRVILHPTYEMYH--PIGGDVALVQL 156

  Fly   127 DPPLPLDSFSTMEAIEIASEQPAVGVQAT---ISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEA 188
            ...:....    ..:.:....|.|.:.:.   .:|||...:.|.:||:||::::|::....|...
Human   157 KTRIVFSE----SVLPVCLATPEVNLTSANCWATGWGLVSKQGETSDELQEMQLPLILEPWCHLL 217

  Fly   189 Y-YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLA----GIVSWGEGCARPNYPGVYANVA 248
            | :...|...|||||.....|..|:||||||||.....:    ||||||.||:.|.||||||:|:
Human   218 YGHMSYIMPDMLCAGDILNAKTVCEGDSGGPLVCEFNRSWLQIGIVSWGRGCSNPLYPGVYASVS 282

  Fly   249 YYKDWI 254
            |:..||
Human   283 YFSKWI 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 78/250 (31%)
Tryp_SPc 28..257 CDD:238113 80/251 (32%)
PRSS38NP_898885.1 Tryp_SPc 60..291 CDD:238113 80/251 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.