DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG31954

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_722915.1 Gene:CG31954 / 33572 FlyBaseID:FBgn0051954 Length:277 Species:Drosophila melanogaster


Alignment Length:241 Identity:96/241 - (39%)
Similarity:142/241 - (58%) Gaps:14/241 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 YAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYNREAE 82
            :.:|.:.|||||||...:.....:.|.|:..|       ..|||.|:....|.|||||.|.:.|:
  Fly    41 WKLSPRLDGRIVGGHRINITDAPHQVSLQTSS-------HICGGSIISEEWILTAAHCTYGKTAD 98

  Fly    83 NFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQ 147
            ...|..| .|....:|.::||.|::.|..:|.:.:|.|.:|:.:..|:..|  .|.:|:::...|
  Fly    99 RLKVRLG-TSEFARSGQLLRVQKIVQHAQFNYTNVDYDFSLLQLAHPIKFD--ETKKAVKLPESQ 160

  Fly   148 PAV--GVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAY-YWRPISEGMLCAGLSEGGKD 209
            ...  |....:||||.|:....|.:.|:||:||:|:.|.|.|.| .:..::|.|:|||..|||||
  Fly   161 MKYMDGEACFVSGWGNTQNLLESREWLRQVEVPLVNQELCSEKYKQYGGVTERMICAGFLEGGKD 225

  Fly   210 ACQGDSGGPLV-VANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            |||||||||:| .:.:|.|:||||.|||:|:|||||:.|::.:|||
  Fly   226 ACQGDSGGPMVSESGELVGVVSWGYGCAKPDYPGVYSRVSFARDWI 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 91/230 (40%)
Tryp_SPc 28..257 CDD:238113 92/231 (40%)
CG31954NP_722915.1 Tryp_SPc 50..271 CDD:214473 91/230 (40%)
Tryp_SPc 51..274 CDD:238113 92/231 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D109274at50557
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.