DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Send1

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608662.1 Gene:Send1 / 33407 FlyBaseID:FBgn0031406 Length:255 Species:Drosophila melanogaster


Alignment Length:258 Identity:84/258 - (32%)
Similarity:119/258 - (46%) Gaps:38/258 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILAVLFLLG-IYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQ-TCGGCILDAVTIA 70
            :|||..|:. :..|..:...||:||:........:.|.|:       .|.: .|||.|.....|.
  Fly     9 LLAVHLLISPVVPVLLEPSERIIGGSSMDITDVPWQVSLQ-------YYGEHFCGGSIYSKTIII 66

  Fly    71 TAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSF 135
            |||||:  :|.|.  .:....|.....||||.|...|.|..::...|:||:|::.:..||   ||
  Fly    67 TAAHCI--KEGER--SIRAGSSLHDSGGVVVGVEAYIIHPQFDKHNMENDVAVLKLSSPL---SF 124

  Fly   136 S-TMEAIEIASEQPAVGVQATISGWGYTKENGL-SSDQLQQVKVPIVDSEKCQEAYYWRPISEGM 198
            | :::.|.:|...|.....|..:|||  :.|.| ...|||.|::.|.....|:..|.....:|. 
  Fly   125 SDSIQTIPLAETDPPTSSSALATGWG--RGNFLIRPRQLQGVEILIRPLIVCKLKYGNGVFNED- 186

  Fly   199 LCAGLSEGGKDACQGDSGGPLVVANKLAGIVS-------WGEGCARPNYPGVYANVAYYKDWI 254
            :|||  ..||..|.||||||||...:|.||.|       .|.        .:||:||.|::||
  Fly   187 ICAG--RMGKGGCYGDSGGPLVFNGQLVGITSRTGNIVCLGS--------SLYASVARYRNWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 77/236 (33%)
Tryp_SPc 28..257 CDD:238113 78/237 (33%)
Send1NP_608662.1 Tryp_SPc 29..239 CDD:214473 77/236 (33%)
Tryp_SPc 30..239 CDD:238113 76/235 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.