DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Ser12

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_523456.1 Gene:Ser12 / 33406 FlyBaseID:FBgn0011832 Length:245 Species:Drosophila melanogaster


Alignment Length:247 Identity:90/247 - (36%)
Similarity:129/247 - (52%) Gaps:17/247 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLFLLGIYAVSA-QSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAH 74
            ::.:..:..:|| .|..|||||      :...:.::..:::...|....||..|.....|.||||
  Fly     6 LVLVASVTLISAGSSPERIVGG------HPVLISEVPWQAALMYSEKYICGAVIYSDKIIITAAH 64

  Fly    75 CVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSST-MDNDIALV-VVDPPLPLDSFST 137
            || .|..:....|........:.|...||:.:..||.|.||| :.||||:: :||   .|...:.
  Fly    65 CV-ERPFDTLYSVRVGSVWKNLGGQHARVAVIRKHEDYVSSTILFNDIAVIRLVD---TLIFNAE 125

  Fly   138 MEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAYYWRPISEGMLCAG 202
            :..|::|...||.|.:|::||||......|....|.:..|.|:|...|:.:|.:  |::.|:||.
  Fly   126 VRPIQLADSAPAAGTEASVSGWGEIGILWLQPTSLLKTSVKILDPNVCKRSYQY--ITKTMICAA 188

  Fly   203 LSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            ...  ||:|.||||||||...:|.||||:|.|||.|.:||||||||..|.||
  Fly   189 ALL--KDSCHGDSGGPLVSGGQLVGIVSYGIGCANPFFPGVYANVAELKPWI 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 85/228 (37%)
Tryp_SPc 28..257 CDD:238113 86/229 (38%)
Ser12NP_523456.1 Tryp_SPc 23..238 CDD:214473 85/228 (37%)
Tryp_SPc 24..238 CDD:238113 84/227 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.