DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG1304

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_608418.1 Gene:CG1304 / 33074 FlyBaseID:FBgn0031141 Length:260 Species:Drosophila melanogaster


Alignment Length:260 Identity:85/260 - (32%)
Similarity:128/260 - (49%) Gaps:23/260 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VILRILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVT 68
            ::|....:|..:.:::.....:||:|||.|.......:.|.||...|.|      |||.||....
  Fly     8 ILLGSFLLLLAVPVHSAPGSLNGRVVGGEDAVKNQFPHQVSLRNAGSHS------CGGSILSRNY 66

  Fly    69 IATAAHCVYNRE---------AENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALV 124
            :.||||||.|::         ||.|.:.||.:.|.. .||:|:|:::|.||.|.:..  ||:||:
  Fly    67 VLTAAHCVTNQDSNGNSVPIAAERFTIRAGSNDRFS-GGVLVQVAEVIVHEEYGNFL--NDVALL 128

  Fly   125 VVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAY 189
            .::.||.|.  ::::.|::.:......|...|||||..|..|.....||...:..:..|:|.|..
  Fly   129 RLESPLILS--ASIQPIDLPTADTPADVDVIISGWGRIKHQGDLPRYLQYNTLKSISLERCDELI 191

  Fly   190 YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            .|...||  ||. :.|....||.||||||.|..|::.|:..:.......:||..||.|.|:.:||
  Fly   192 GWGVQSE--LCL-IHEADNGACNGDSGGPAVYNNQVVGVAGFVWSACGTSYPDGYARVYYHNEWI 253

  Fly   255  254
              Fly   254  253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 80/235 (34%)
Tryp_SPc 28..257 CDD:238113 81/236 (34%)
CG1304NP_608418.1 Tryp_SPc 31..253 CDD:214473 80/235 (34%)
Tryp_SPc 32..256 CDD:238113 81/236 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
44.030

Return to query results.
Submit another query.