DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Ser6

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_523426.1 Gene:Ser6 / 33073 FlyBaseID:FBgn0011834 Length:259 Species:Drosophila melanogaster


Alignment Length:263 Identity:94/263 - (35%)
Similarity:133/263 - (50%) Gaps:26/263 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 ILRILAVLFL-LGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVT 68
            ||....:||| |.:.:...:.:||:|||.|.......:.|.||...|.|      |||.||....
  Fly     8 ILLCSFLLFLVLPVQSAPGKLNGRVVGGEDAVKNQFPHQVSLRNAGSHS------CGGSILTRTY 66

  Fly    69 IATAAHCVYNRE---------AENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALV 124
            |.||||||.|.:         ||.|.:.||.:.|.. .||:|:|:::|.||.|.:..  ||:||:
  Fly    67 ILTAAHCVSNEDVNHVITPIAAERFTIRAGSNDRFS-GGVLVQVAEVIVHEEYGNFL--NDVALL 128

  Fly   125 VVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAY 189
            .::.||.|.  ::::.|::.:......|...|||||..|..|.....||...:..:..::|:|..
  Fly   129 RLESPLILS--ASIQPIDLPTVDTPADVDVVISGWGRIKHQGDLPRYLQYNTLKSITRQQCEELI 191

  Fly   190 YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSW-GEGCARPNYPGVYANVAYYKDW 253
            .:.  .||.||. |.:....||.||||||.|..|:|.|:..: .:||. ..||..||.|.|:|||
  Fly   192 DFG--FEGELCL-LHQVDNGACNGDSGGPAVYNNQLVGVAGFVVDGCG-STYPDGYARVFYFKDW 252

  Fly   254 IAK 256
            |.|
  Fly   253 IKK 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 84/236 (36%)
Tryp_SPc 28..257 CDD:238113 86/239 (36%)
Ser6NP_523426.1 Tryp_SPc 31..253 CDD:214473 84/236 (36%)
Tryp_SPc 32..256 CDD:238113 86/239 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG25816
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.