DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Prss34

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_848459.1 Gene:Prss34 / 328780 MGIID:2681414 Length:318 Species:Mus musculus


Alignment Length:278 Identity:91/278 - (32%)
Similarity:134/278 - (48%) Gaps:32/278 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRILAVLFL----------LGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCG 60
            |.:|.:|||          |.:...|.|....||||...|:....:.|.||......|.:...||
Mouse     3 LGMLWLLFLSLPCLGNTMPLTLDLGSGQGLVGIVGGCPVSASRFPWQVSLRLYDMEHSRWEHECG 67

  Fly    61 GCILDAVTIATAAHCVYNREAENFLV-VAGDDSRGGMNGVVVRVSKLIPHELYN---SSTMDNDI 121
            |.::....:.||||||..:|.|.:.| |.....|...|..:::|.|:|.|..::   |:....||
Mouse    68 GSLIHPQWVLTAAHCVRPKEVEAYGVRVQVGQLRLYENDQLMKVVKIIRHPKFSEKLSARGGADI 132

  Fly   122 ALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSD---QLQQVKVPIVDSE 183
            ||:.:|..:.|.......::..||.:.:......::|||.. ||.:...   .|::|.||||::.
Mouse   133 ALLKLDTRVVLSEHVYPVSLPAASLRISSKKTCWVAGWGVI-ENYMPLPPPYHLREVAVPIVENN 196

  Fly   184 KCQEAYY--------WRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLA----GIVSWGEGCA 236
            .|::.|.        .|.|.:.|||||  :.|:|:|:.|||||||.....:    |:||||.||.
Mouse   197 DCEQKYQTNSSSDSTTRIIKDDMLCAG--KEGRDSCKADSGGPLVCRWNCSWVQVGVVSWGIGCG 259

  Fly   237 RPNYPGVYANVAYYKDWI 254
            .|::||||..|..|..||
Mouse   260 LPDFPGVYTRVMSYVSWI 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 81/245 (33%)
Tryp_SPc 28..257 CDD:238113 83/246 (34%)
Prss34NP_848459.1 Tryp_SPc 35..278 CDD:238113 83/246 (34%)
Tryp_SPc 35..277 CDD:214473 81/244 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.