DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG9672

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_573151.1 Gene:CG9672 / 32651 FlyBaseID:FBgn0030777 Length:253 Species:Drosophila melanogaster


Alignment Length:266 Identity:74/266 - (27%)
Similarity:120/266 - (45%) Gaps:28/266 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KVILRILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAV 67
            |:.|.|..:|...|:  :.||..|||.||.|.      .:.||..:::.|...:..||..|:...
  Fly     2 KLTLTIGLILVAAGV--LEAQPQGRIAGGEDA------VLGQLPYQAALSIGGSYNCGAVIIGQR 58

  Fly    68 TIATAAHCVYNREAEN------FLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVV 126
            ...||..||.:...:.      |.|..|  |....||..:||.::..:.  |.||:...|||:.:
  Fly    59 YALTALSCVCSDGKDTPWAAVLFAVTVG--SVDLYNGKQIRVEEITINP--NYSTLKTGIALLRL 119

  Fly   127 DPPLPLDSFS-TMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQV-KVPIVDSEKCQEAY 189
            ...:   :|| |:.||.::.:.|.:|.|..:||||.|.|:.::..:..|: ...::...:|..|.
  Fly   120 QEEI---TFSETVNAIPLSQDVPPMGSQVEVSGWGRTTESEVNMHRTLQIGAAEVMAPRECALAN 181

  Fly   190 YWRPI--SEGMLCAGLSEGGKDA-CQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYK 251
            ....:  .:.:||.|  .|.:.. |.||.|||.|...:|.|:.:...|......|..:.::|...
  Fly   182 RDELLVADDQVLCLG--HGRRQGICSGDIGGPAVYQGQLVGLGAQILGECGGMLPERFISIAANY 244

  Fly   252 DWIAKQ 257
            |||.:|
  Fly   245 DWIQQQ 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 63/237 (27%)
Tryp_SPc 28..257 CDD:238113 64/239 (27%)
CG9672NP_573151.1 Tryp_SPc 24..247 CDD:214473 63/237 (27%)
Tryp_SPc 25..250 CDD:238113 64/239 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.