DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG31681

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_722789.1 Gene:CG31681 / 318882 FlyBaseID:FBgn0051681 Length:264 Species:Drosophila melanogaster


Alignment Length:266 Identity:98/266 - (36%)
Similarity:139/266 - (52%) Gaps:41/266 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 ILAVLFLLGIYAVSAQSDG---RIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTI 69
            :|::|..:...|.:|:..|   |||||:.....|..:.|.::..|      ...|||.|.....|
  Fly     6 LLSILVSIAGLACAARIPGPEERIVGGSYIPIEYVPWQVSVQNNS------LHCCGGVIYSDRAI 64

  Fly    70 ATAAHCVYNREAENFLVVAGDD--SRGGMNGVVVRVSKLIPH-----ELYNSSTMDNDIALVVVD 127
            .|||||:.|....:..|.||..  |:||.   |::|.|.|.|     :|||    ..|||:::::
  Fly    65 LTAAHCLSNVTVTDLSVRAGSSYWSKGGQ---VLKVLKTIAHPKYVPKLYN----PYDIAVLILE 122

  Fly   128 PPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSS---DQLQQVKVPIVDSEKCQEAY 189
            .||.|.  .|::.|.:|.:.|..|.....||||||:||  ||   ..||.|.|.|::...|.:||
  Fly   123 APLRLG--GTVKKIPLAEQTPVAGTIVLTSGWGYTREN--SSFLWPILQGVHVAILNRTDCLKAY 183

  Fly   190 YWRPISEGMLCAGLSEGGK-DACQGDSGGPLVVANK-----LAGIVSWGEGCARPNYPGVYANVA 248
            ....|:..|:||   :|.: |.|||||||||:...|     |.|:||||:||.  ..||||.::|
  Fly   184 KHVNITIDMICA---DGQRWDTCQGDSGGPLIETTKGGHRQLIGMVSWGDGCG--TNPGVYEDIA 243

  Fly   249 YYKDWI 254
            ::.:||
  Fly   244 FFHNWI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 91/242 (38%)
Tryp_SPc 28..257 CDD:238113 92/243 (38%)
CG31681NP_722789.1 Tryp_SPc 28..249 CDD:214473 91/242 (38%)
Tryp_SPc 29..250 CDD:238113 92/243 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D104239at33392
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.