DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG31267

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_732214.1 Gene:CG31267 / 318651 FlyBaseID:FBgn0051267 Length:275 Species:Drosophila melanogaster


Alignment Length:232 Identity:76/232 - (32%)
Similarity:112/232 - (48%) Gaps:14/232 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGADTSSYYTKYVVQLRRRSSSSSSYA-QTCGGCILDAVTIATAAHCVYNREAENFLVVAGD 90
            |||||.::......|:|.|:      ::|. ..|.|.|:....:.|||.|:......|..||...
  Fly    44 RIVGGEESDVLAAPYLVSLQ------NAYGNHFCAGSIIHDQWVITAASCLAGLRKNNVQVVTTT 102

  Fly    91 DSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEIAS-EQPAVGVQA 154
            .:..|..|.:..|..::.|..::|....|||||:........|..:  :.|.||. |....|...
  Fly   103 YNHWGSEGWIYSVEDIVMHCNFDSPMYHNDIALIKTHALFDYDDVT--QNITIAPLEDLTDGETL 165

  Fly   155 TISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAYYWRP-ISEGMLCAGLSEGGKDACQGDSGGP 218
            |:.|:|.|:..|..|.||||:.|..|..|||...|...| :..|.||| :.:.|..||.||:|||
  Fly   166 TMYGYGSTEIGGDFSWQLQQLDVTYVAPEKCNATYGGTPDLDVGHLCA-VGKVGAGACHGDTGGP 229

  Fly   219 LVVA-NKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            :|.: .:|.|:.:||..|.. .:|.|:|.:::|..||
  Fly   230 IVDSRGRLVGVGNWGVPCGY-GFPDVFARISFYYSWI 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 74/230 (32%)
Tryp_SPc 28..257 CDD:238113 75/231 (32%)
CG31267NP_732214.1 Tryp_SPc 44..265 CDD:214473 74/230 (32%)
Tryp_SPc 45..268 CDD:238113 75/231 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439366
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.