DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG32834

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001188996.1 Gene:CG32834 / 318238 FlyBaseID:FBgn0052834 Length:556 Species:Drosophila melanogaster


Alignment Length:271 Identity:87/271 - (32%)
Similarity:121/271 - (44%) Gaps:49/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LFLLGIYAVSAQSD----GRIVGGADT----SSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVT 68
            ||||.......:.|    .||:||.|.    :.|..:.::          .....|.|.|:.:.|
  Fly     7 LFLLAALLRPVRGDLDAQSRIIGGYDVDIEDAPYQAEVII----------DGTAICSGAIITSDT 61

  Fly    69 IATAAHCVYNREAENFLVVAGDDSRG-GMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPL 132
            |.|||.||  :...:..|..|..||. ...|.::.|.::|.|..||....||::||:.:..||  
  Fly    62 IITAASCV--QSYGSIEVRVGTSSRDYDGTGFLLEVCEIINHPQYNCWRFDNNLALLKLCDPL-- 122

  Fly   133 DSFSTMEAIE---IASEQPAVGVQATISGWGYT--------KENGLSSDQLQQVKVPIVDSEKC- 185
               .|.|||:   ||.::|..|...|:||||.|        :..|...|.||...|.:.:.|:| 
  Fly   123 ---KTSEAIQPISIAEDEPDDGSWCTVSGWGSTSWWGSWWDRCFGSLPDYLQMAWVSVYNREQCA 184

  Fly   186 QEAYYW-----RPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYA 245
            .:...|     ..||...||.....||   |..|:|.|||:..:|.||:|.| ||.  ..|.|||
  Fly   185 ADRGVWFGLWDNGISYLTLCTHNGAGG---CSYDTGAPLVIDGQLVGILSEG-GCT--TKPDVYA 243

  Fly   246 NVAYYKDWIAK 256
            ||.::..|||:
  Fly   244 NVPWFTGWIAE 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 79/248 (32%)
Tryp_SPc 28..257 CDD:238113 81/251 (32%)
CG32834NP_001188996.1 Tryp_SPc 26..252 CDD:214473 79/248 (32%)
Tryp_SPc 27..255 CDD:238113 81/251 (32%)
BES1_N <293..343 CDD:283367
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000678
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.