DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Prtn3

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_038934901.1 Gene:Prtn3 / 314615 RGDID:1304898 Length:422 Species:Rattus norvegicus


Alignment Length:266 Identity:64/266 - (24%)
Similarity:101/266 - (37%) Gaps:51/266 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAA 73
            |..|.|.|:....|....:||||.:...:...||..|:...|..|.:   |||.::....:.|||
  Rat   179 LPCLRLAGVRFHGAVQASKIVGGHEARPHSRPYVASLQLSRSPGSHF---CGGTLIHPRFVLTAA 240

  Fly    74 HCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHEL-------------------YNSSTMDN 119
            ||:.:...:...||.|                  .|:|                   ||.....|
  Rat   241 HCLQDISWQLVTVVLG------------------AHDLLSSEPEQQKFTITQVFENNYNPEETLN 287

  Fly   120 DIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEK 184
            |:.|:.::.|..|.....:.::....:..:.|.|....|||.......:...|.::.|.:| :..
  Rat   288 DVLLLQLNRPASLGKQVAVASLPQQDQSLSQGTQCLAMGWGRLGTRAPTPRVLHELNVTVV-TFL 351

  Fly   185 CQEAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWG-EGCARPNYPGVYANVA 248
            |:         |..:|..:.......|.|||||||:....|.|:.|:. ..||...:|..:|.|:
  Rat   352 CR---------EHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVS 407

  Fly   249 YYKDWI 254
            .|.:||
  Rat   408 MYVNWI 413

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 57/246 (23%)
Tryp_SPc 28..257 CDD:238113 59/247 (24%)
Prtn3XP_038934901.1 Tryp_SPc 198..416 CDD:238113 59/247 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.