DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and CG3795

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001284790.1 Gene:CG3795 / 31128 FlyBaseID:FBgn0025378 Length:305 Species:Drosophila melanogaster


Alignment Length:283 Identity:83/283 - (29%)
Similarity:133/283 - (46%) Gaps:46/283 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLFLLGIYAVSAQSDGR-----------------------IVGG--ADTSSYYTKYVVQLR---- 46
            |:::| :.:|||.|:..                       :.||  .||:. ..||.|.||    
  Fly     7 VVYIL-LISVSANSNSESQAGQLHSAPSQRQDRPSDFQFLVTGGYRPDTND-LVKYTVSLRMGKP 69

  Fly    47 RRSSSSSSYAQTCGGCILDAVTIATAAHCVY-NR---EAENFLVVAGDDSR--GGMNGVVVRVSK 105
            ::....:.:   |.|.|.....|.|||||:: ||   :|:..:||||...|  ......::...:
  Fly    70 KKFFGDNHF---CAGTIFSERAILTAAHCMFSNRRKLKAKKLMVVAGTPRRLLKSSTTQIIEAEE 131

  Fly   106 LIPHELY-NSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSS 169
            |:||..| ...:...||.|::::..|.|.  ..:..|.:.::.|..|...:|.|||...:.|...
  Fly   132 LLPHPKYKKGKSQKYDIGLILLEADLSLG--DAVAKIPLYNKVPVAGAPCSIVGWGTVIQFGPLP 194

  Fly   170 DQLQQVKVPIVDSEKCQEAYYWRPISEGMLCAG-LSEGGKDACQGDSGGPLVVANKLAGIVSWGE 233
            |:.....:.|:....|::...|.  :.|||||. ..:...|:|||||||||:..|.:.||||:|.
  Fly   195 DEAINGDMQILPDTFCEKLLGWS--NAGMLCANDKHDSDVDSCQGDSGGPLICDNMVTGIVSFGM 257

  Fly   234 GCARPNYPGVYANVAYYKDWIAK 256
            ||..|:..|:|.:|.:::|||.:
  Fly   258 GCGEPDSAGIYTDVYHFRDWITE 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 75/263 (29%)
Tryp_SPc 28..257 CDD:238113 77/243 (32%)
CG3795NP_001284790.1 Tryp_SPc 60..281 CDD:238113 72/228 (32%)
Tryp_SPc 60..278 CDD:214473 70/224 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455598
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24276
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.