DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Klk12

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_008757573.1 Gene:Klk12 / 308564 RGDID:1308975 Length:247 Species:Rattus norvegicus


Alignment Length:272 Identity:85/272 - (31%)
Similarity:124/272 - (45%) Gaps:60/272 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 LAVLFLLGIYAVSAQSDGRIVGGAD---------TSSYYTKYVVQLRRRSSSSSSYAQTCGGCIL 64
            |.:|.||.:..:|.....:|..|.:         ...::.||:               .|||.::
  Rat     3 LNILLLLCVVGLSQADREKIYNGVECVKNSQPWQVGLFHGKYL---------------RCGGVLV 52

  Fly    65 DAVTIATAAHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKL------------IPHELYNSS-- 115
            |...:.|||||     :..::|..|:.|          :|||            |.|..|:.:  
  Rat    53 DRKWVLTAAHC-----SGKYMVRLGEHS----------LSKLDLTEQLRLTTFSITHPSYHGAYQ 102

  Fly   116 TMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYT-KENGLSSDQLQQVKVPI 179
            ..::|:.|:.::.|:.|.  ..:..:.:.|.....|.:..|||||.| |......|:||.:.:.|
  Rat   103 NHEHDLRLLRLNRPISLT--YAVRPVALPSSCAPTGAKCHISGWGTTNKPWDPFPDRLQCLDLSI 165

  Fly   180 VDSEKCQEAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGE--GCARPNYPG 242
            |.:|.|:..:..| ::|.||||| .|.||||||||||||||....|.|:||||.  .|.:...||
  Rat   166 VSNETCRAVFPGR-VTENMLCAG-GEAGKDACQGDSGGPLVCGGVLQGLVSWGSVGPCGQKGIPG 228

  Fly   243 VYANVAYYKDWI 254
            ||..|..|.|||
  Rat   229 VYTKVCKYTDWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 78/252 (31%)
Tryp_SPc 28..257 CDD:238113 80/253 (32%)
Klk12XP_008757573.1 Tryp_SPc 21..240 CDD:214473 78/252 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.