DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Elane

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001100237.1 Gene:Elane / 299606 RGDID:1307968 Length:271 Species:Rattus norvegicus


Alignment Length:250 Identity:70/250 - (28%)
Similarity:107/250 - (42%) Gaps:31/250 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYN 78
            ||.:..|.......||||.....:...::|.|:||.      ...||..::....:.:|||||..
  Rat    19 LLALLLVCPALASEIVGGRPAQPHAWPFMVSLQRRG------GHFCGATLIARNFVMSAAHCVNG 77

  Fly    79 REAENFLVVAG--DDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAI 141
            |..::..||.|  |..|......:..|.::..:. ::.|.:.|||.::      .|:..:|:.|.
  Rat    78 RNFQSVQVVLGAHDLRRREPTRQIFSVQRIFENG-FDPSRLLNDIVII------QLNGSATINAN 135

  Fly   142 EIASEQPAVG------VQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAYYWRPISEGMLC 200
            ...:|.||.|      ......|||....|......||::.|.:| :..|:     |.::   :|
  Rat   136 VQVAELPAQGQGVGNRTPCVAMGWGRLGTNRPLPSVLQELNVTVV-TNLCR-----RRVN---VC 191

  Fly   201 AGLSEGGKDACQGDSGGPLVVANKLAGIVSW-GEGCARPNYPGVYANVAYYKDWI 254
            ..:.......|.||||||||..|.:.||.|: ..||....||..:|.||.:.|||
  Rat   192 TLVPRRQAGICFGDSGGPLVCNNLVQGIDSFIRGGCGSGFYPDAFAPVAEFADWI 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 65/235 (28%)
Tryp_SPc 28..257 CDD:238113 66/235 (28%)
ElaneNP_001100237.1 Tryp_SPc 32..246 CDD:214473 65/235 (28%)
Tryp_SPc 33..249 CDD:238113 66/235 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.