DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Klk1c3

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001258244.1 Gene:Klk1c3 / 292872 RGDID:735032 Length:255 Species:Rattus norvegicus


Alignment Length:268 Identity:81/268 - (30%)
Similarity:124/268 - (46%) Gaps:49/268 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VLFL---LGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATA 72
            :|||   ||....:.....|:|||.........:.|.:...        ..|||.::|...:.||
  Rat     5 ILFLALSLGQIDAAPPGQSRVVGGFKCEKNSQPWQVAVINE--------DLCGGVLIDPSWVITA 61

  Fly    73 AHCVYNREAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSS-------------------TMD 118
            |||.    ::|:.|:.|.::          :|:.:.|.|.:.|                   ...
  Rat    62 AHCY----SDNYHVLLGQNN----------LSEDVQHRLVSQSFRHPDYKPFLMRNHTRKPKDYS 112

  Fly   119 NDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLS-SDQLQQVKVPIVDS 182
            ||:.|:.:..  |.|....::.|::.:::|.||....:||||.|..:... .|.||.|.:.::.:
  Rat   113 NDLMLLHLSE--PADITDGVKVIDLPTKEPKVGSTCLVSGWGSTNPSEWEFPDDLQCVNIHLLSN 175

  Fly   183 EKCQEAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGE-GCARPNYPGVYAN 246
            |||.:||. ..:::.|||||..|||||.|:|||||||:....|.||.|||. .|..||.||:|..
  Rat   176 EKCIKAYK-EKVTDLMLCAGELEGGKDTCRGDSGGPLICDGVLQGITSWGSVPCGEPNKPGIYTK 239

  Fly   247 VAYYKDWI 254
            :..:..||
  Rat   240 LIKFTSWI 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 74/247 (30%)
Tryp_SPc 28..257 CDD:238113 75/248 (30%)
Klk1c3NP_001258244.1 Tryp_SPc 24..247 CDD:214473 74/247 (30%)
Tryp_SPc 25..250 CDD:238113 75/248 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.