DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Klk9

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001099723.1 Gene:Klk9 / 292851 RGDID:1308280 Length:258 Species:Rattus norvegicus


Alignment Length:270 Identity:88/270 - (32%)
Similarity:133/270 - (49%) Gaps:33/270 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRILAVLFLLGIYAVSAQSDGRIVGGAD---TSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAV 67
            :::...|.|..:.|....:|.|.||..:   .|..:...:..|.|         |.||..:::..
  Rat     1 MKLGLTLVLFSLLAGHCGADTRAVGARECQRNSQPWQAGLFYLTR---------QLCGATLINDQ 56

  Fly    68 TIATAAHC----VYNREAENFL-VVAGDDSRGGMNGVVVRVSKLIPHELYNS--STMDNDIALVV 125
            .:.|||||    ::.|..|:.| ...|.:.       ::.|:...||..:|.  |..|::..:::
  Rat    57 WLLTAAHCRKPYLWVRLGEHHLWQWEGPEK-------LLLVTDFFPHPGFNPDLSANDHNDDIML 114

  Fly   126 VDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQ-LQQVKVPIVDSEKCQEAY 189
            :..|..:.....::.:.::...|:||.|..|||||....:.:.... ||...:.|:|::.|:.||
  Rat   115 IRLPRKVRLSPAVQPLNLSQSLPSVGTQCLISGWGSVSSSKIQFPMTLQCANISILDNKLCRWAY 179

  Fly   190 YWRP--ISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWG-EGCARPNYPGVYANVAYYK 251
               |  |||.||||||.|||:.:||||||||||....||||||.| |.|:||..|.||.:|.:|.
  Rat   180 ---PGHISEKMLCAGLWEGGRGSCQGDSGGPLVCKGTLAGIVSGGSEPCSRPQRPAVYTSVFHYL 241

  Fly   252 DWIAKQRTSY 261
            |||......|
  Rat   242 DWIENTVEKY 251

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 81/240 (34%)
Tryp_SPc 28..257 CDD:238113 82/242 (34%)
Klk9NP_001099723.1 Tryp_SPc 24..247 CDD:238113 82/241 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.