DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Klk10

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001004100.1 Gene:Klk10 / 292850 RGDID:1303242 Length:279 Species:Rattus norvegicus


Alignment Length:214 Identity:63/214 - (29%)
Similarity:100/214 - (46%) Gaps:27/214 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 CGGCILDAVTIATAAHCVYN-----REAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNS---- 114
            |.|.::|...:.|||||..|     |..::.|::...:.....|..|.       |..|..    
  Rat    72 CAGVLVDQNWVLTAAHCWRNKPLRARVGDDHLLLFQSEQLRSTNSPVF-------HPKYQPCSGP 129

  Fly   115 ----STMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQ-LQQ 174
                .:.::|:.::.:..|:.|.|......:.....||....|  :||||.|....:..:: |..
  Rat   130 VLPLRSDEHDLMMLKLSSPVVLTSKVHPVQLPFQCAQPRQECQ--VSGWGTTANRRVKYNRSLSC 192

  Fly   175 VKVPIVDSEKCQEAYYWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWG-EGC-AR 237
            .:|.::..::| |.:|...|:..|:|||: :..:|:||.|||||||..|.|.||:||. ..| |.
  Rat   193 SRVTLLSQKQC-ETFYPGVITNNMICAGM-DRDQDSCQSDSGGPLVCDNTLHGILSWSIYPCGAA 255

  Fly   238 PNYPGVYANVAYYKDWIAK 256
            ..||.|||.:..|.:||.:
  Rat   256 TQYPAVYAKICNYTNWIRR 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 61/210 (29%)
Tryp_SPc 28..257 CDD:238113 63/214 (29%)
Klk10NP_001004100.1 Tryp_SPc 50..272 CDD:214473 61/210 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.