DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Klk11

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_001099722.1 Gene:Klk11 / 292849 RGDID:1308690 Length:279 Species:Rattus norvegicus


Alignment Length:268 Identity:85/268 - (31%)
Similarity:131/268 - (48%) Gaps:43/268 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 VILRILAVLFLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVT 68
            :|||.:|:..:.|    ....:.||:.|.:...:...:.|.|.:::      ...||..::....
  Rat    31 MILRFIALALVTG----HVGGETRIIKGYECRPHSQPWQVALFQKT------RLLCGATLIAPKW 85

  Fly    69 IATAAHCVYNREAENFLVVAGDDSRGGMNGVVVR--VSKLIPHELYNSSTMD----NDIALVVVD 127
            :.|||||    ...:::::.|:.:....:|...|  .::..||..:|:|..:    |||.||.:.
  Rat    86 LLTAAHC----RKPHYVILLGEHNLEKTDGCEQRRMATESFPHPGFNNSLPNKDHRNDIMLVKMS 146

  Fly   128 PPLPLDSFST--MEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQ------VKVPIVDSEK 184
            .|    :|.|  :..:.::|.....|....|||||.|     ||.||:.      ..|.|:..::
  Rat   147 SP----AFITRAVRPLTLSSLCVTAGTSCLISGWGTT-----SSPQLRLPHSLRCANVSIIGHKE 202

  Fly   185 CQEAYYWRP--ISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEG-CARPNYPGVYAN 246
            |:.||   |  |::.||||.:.:.|||:||||||||||....|.||:|||:. ||....||||..
  Rat   203 CERAY---PGNITDTMLCASVRKEGKDSCQGDSGGPLVCNGSLQGIISWGQDPCAVTRKPGVYTK 264

  Fly   247 VAYYKDWI 254
            |..|.|||
  Rat   265 VCKYFDWI 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 78/243 (32%)
Tryp_SPc 28..257 CDD:238113 79/244 (32%)
Klk11NP_001099722.1 Tryp_SPc 50..272 CDD:214473 78/243 (32%)
Tryp_SPc 51..275 CDD:238113 79/244 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.