DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Prss29

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:XP_017453326.1 Gene:Prss29 / 287136 RGDID:1305856 Length:279 Species:Rattus norvegicus


Alignment Length:258 Identity:85/258 - (32%)
Similarity:133/258 - (51%) Gaps:34/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 IVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYNREAE--NFLVVAGD 90
            ||||.........:.|.||....:.:|:...|||.|:....:.|||||::..:|:  .|.:..|.
  Rat    31 IVGGNSAPQGKWPWQVSLRVYRYNWASWVHICGGSIIHPQWVLTAAHCIHESDADPSAFRIYLGQ 95

  Fly    91 -DSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQA 154
             ...||..  :::||::|.|..:..|.:.:|:||:.:  ...:.||..::.::::   || .::.
  Rat    96 VYLYGGEK--LLKVSRVIIHPDFVRSGLGSDVALLQL--AQSVRSFPNVKPVKLS---PA-SLEV 152

  Fly   155 T------ISGWGYTK--ENGLSSDQLQQVKVPIVDSEKCQEAYY---------WRPISEGMLCAG 202
            |      ::|||...  |:.....:||||:|.|||:..|::.|.         .|.|.:.|||||
  Rat   153 TKKDVCWVTGWGSVSMHESLPPPYRLQQVQVKIVDNTLCEKLYRNATRLSNHGQRLILQDMLCAG 217

  Fly   203 LSEGGKDACQGDSGGPLVV----ANKLAGIVSWGEGCARPNYPGVYANVAYYKDWIAKQRTSY 261
              ..|:|:|.||||||||.    :..|.|:||||.|||..:.|||||.|.::..||..|...:
  Rat   218 --SHGRDSCYGDSGGPLVCNVTGSWTLVGVVSWGYGCALKDIPGVYARVQFFLPWITGQMQKF 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 82/249 (33%)
Tryp_SPc 28..257 CDD:238113 84/252 (33%)
Prss29XP_017453326.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.