DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and LOC286960

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_775423.1 Gene:LOC286960 / 286960 RGDID:708585 Length:247 Species:Rattus norvegicus


Alignment Length:249 Identity:82/249 - (32%)
Similarity:119/249 - (47%) Gaps:24/249 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 FLLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVY 77
            ||....|:....|.:||||.....:...|.|.|.      ...:..|||.::....:.:|||| |
  Rat     9 FLGAAVALPVNDDDKIVGGYTCPKHLVPYQVSLH------DGISHQCGGSLISDQWVLSAAHC-Y 66

  Fly    78 NREAE------NFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFS 136
            .|:.:      |..|:.|.:.       .:...|:|.|..||..|:||||.|:.:..|..|:  |
  Rat    67 KRKLQVRLGEHNIHVLEGGEQ-------FIDAEKIIRHPEYNKDTLDNDIMLIKLKSPAVLN--S 122

  Fly   137 TMEAIEIASEQPAVGVQATISGWGYTKE-NGLSSDQLQQVKVPIVDSEKCQEAYYWRPISEGMLC 200
            .:..:.:.....:...|..:||||.|.. .|.....||.::.|::.:..|:::|..: |:..|.|
  Rat   123 QVSTVSLPRSCASTDAQCLVSGWGNTVSIGGKYPALLQCLEAPVLSASSCKKSYPGQ-ITSNMFC 186

  Fly   201 AGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            .|..|||||:|.||||||:|...::.||||||..||....||||..|..|..||
  Rat   187 LGFLEGGKDSCDGDSGGPVVCNGEIQGIVSWGSVCAMRGKPGVYTKVCNYLSWI 240

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 76/233 (33%)
Tryp_SPc 28..257 CDD:238113 78/234 (33%)
LOC286960NP_775423.1 Tryp_SPc 23..240 CDD:214473 76/233 (33%)
Tryp_SPc 24..243 CDD:238113 78/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.