DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Prss3b

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_775150.1 Gene:Prss3b / 286911 RGDID:708437 Length:247 Species:Rattus norvegicus


Alignment Length:260 Identity:90/260 - (34%)
Similarity:136/260 - (52%) Gaps:29/260 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 AVLFLLGIYAVSA----QSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIA 70
            |::||..:.|..|    ..|.:||||      ||.....|..:.|.::.| ..|||.::::..:.
  Rat     3 ALIFLAFLGAAVALPLDDDDDKIVGG------YTCQKNSLPYQVSLNAGY-HFCGGSLINSQWVV 60

  Fly    71 TAAHCVYNR-----EAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPL 130
            :||||..:|     ...|..||.|.:.       .:..:|:|.|..||::|.||||.|:.::.|.
  Rat    61 SAAHCYKSRIQVRLGEHNIDVVEGGEQ-------FIDAAKIIRHPSYNANTFDNDIMLIKLNSPA 118

  Fly   131 PLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQ-VKVPIVDSEKCQEAYYWRPI 194
            .|:  |.:..:.:.....:.|.:..:||||.|..:|.:...|.| :..|::....|:.:|..: |
  Rat   119 TLN--SRVSTVSLPRSCGSSGTKCLVSGWGNTLSSGTNYPSLLQCLDAPVLSDSSCKSSYPGK-I 180

  Fly   195 SEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWIAKQRT 259
            :..|.|.|..|||||:||||||||:|...:|.|:||||.|||:...||||..|..|.:||  |:|
  Rat   181 TSNMFCLGFLEGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQKGKPGVYTKVCNYVNWI--QQT 243

  Fly   260  259
              Rat   244  243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 80/232 (34%)
Tryp_SPc 28..257 CDD:238113 82/234 (35%)
Prss3bNP_775150.1 Tryp_SPc 24..240 CDD:214473 80/232 (34%)
Tryp_SPc 25..243 CDD:238113 83/236 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.