DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Tmprss11d

DIOPT Version :10

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_663536.1 Gene:Tmprss11d / 231382 MGIID:2385221 Length:417 Species:Mus musculus


Alignment Length:67 Identity:20/67 - (29%)
Similarity:29/67 - (43%) Gaps:5/67 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GFAGDLVKVFIREGDRELVILCKLLPENETRKQQGISLFVRETVAYMQILPLLLKFQ---DEKAL 105
            |...:.||..|..|.|.  |....:..|||...:||...:::.|...:.|.::.|..   .||||
Mouse    26 GKVAEAVKAAIAAGYRH--IDGAAVYNNETEVGEGIKAMIKDGVVKREELFVVSKLWCTFHEKAL 88

  Fly   106 AK 107
            .|
Mouse    89 VK 90

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 20/67 (30%)
Tmprss11dNP_663536.1 SEA 48..140 CDD:460188 13/43 (30%)
Tryp_SPc 186..414 CDD:238113
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.