DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Prss3

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_035775.1 Gene:Prss3 / 22073 MGIID:102758 Length:246 Species:Mus musculus


Alignment Length:256 Identity:96/256 - (37%)
Similarity:132/256 - (51%) Gaps:24/256 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LRILAVLFLLG-IYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTI 69
            :..|.:|.|:| ..|.....|.:||||.........|.|.|      :|.| ..|||.:::...:
Mouse     1 MNALLILALVGAAVAFPVDDDDKIVGGYTCQENSVPYQVSL------NSGY-HFCGGSLINDQWV 58

  Fly    70 ATAAHCVYNR-----EAENFLVVAGDDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPP 129
            .:||||...|     ...|..|:.|::.       .|..:|:|.|..:|..|::|||.|:.:..|
Mouse    59 VSAAHCYKTRIQVRLGEHNINVLEGNEQ-------FVNAAKIIKHPNFNRKTLNNDIMLLKLSSP 116

  Fly   130 LPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSS-DQLQQVKVPIVDSEKCQEAYYWRP 193
            :.|:  :.:..:.:.|.....|.|..|||||.|...|:|. |.||.:..|::....| ||.|...
Mouse   117 VTLN--ARVATVALPSSCAPAGTQCLISGWGNTLSFGVSEPDLLQCLDAPLLPQADC-EASYPGK 178

  Fly   194 ISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWGEGCARPNYPGVYANVAYYKDWI 254
            |:..|:|||..|||||:||||||||:|...:|.||||||.|||.|:.||||..|..|.|||
Mouse   179 ITGNMVCAGFLEGGKDSCQGDSGGPVVCNRELQGIVSWGYGCALPDNPGVYTKVCNYVDWI 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 88/232 (38%)
Tryp_SPc 28..257 CDD:238113 90/233 (39%)
Prss3NP_035775.1 Tryp_SPc 23..239 CDD:214473 88/232 (38%)
Tryp_SPc 24..242 CDD:238113 90/233 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BBP0
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.