DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and PRSS55

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_940866.2 Gene:PRSS55 / 203074 HGNCID:30824 Length:352 Species:Homo sapiens


Alignment Length:241 Identity:80/241 - (33%)
Similarity:122/241 - (50%) Gaps:21/241 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 RIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYNRE--AENFLVVAG 89
            ||.||.:.......:.|.::.||.      ..|||.||:...|.|||||:|:.|  .|...||.|
Human    67 RITGGMEAEVGEFPWQVSIQARSE------PFCGGSILNKWWILTAAHCLYSEELFPEELSVVLG 125

  Fly    90 DDSRGGMNGVVVRVSKLIPHELYNSSTMDNDIALVVVDPPLPLDSFSTMEAIEIASEQPAVGVQA 154
            .:.....:..:..|:.:|.|:.:..:.|||||||:::..|:.||.......:. ....||...:.
Human   126 TNDLTSPSMEIKEVASIILHKDFKRANMDNDIALLLLASPIKLDDLKVPICLP-TQPGPATWREC 189

  Fly   155 TISGWGYTK---ENGLSSDQLQQVKVPIVDSEKCQEAYYWRPISEGMLCAGLSEGGKDACQGDSG 216
            .::|||.|.   :|.:.:| |.:..:.|:|.|:|.:.:  ..:::.|||||......|||:||||
Human   190 WVAGWGQTNAADKNSVKTD-LMKAPMVIMDWEECSKMF--PKLTKNMLCAGYKNESYDACKGDSG 251

  Fly   217 GPLVVANK------LAGIVSWGEGCARPNYPGVYANVAYYKDWIAK 256
            ||||...:      ..||:|||:.|...|.||:|.::..|..||.|
Human   252 GPLVCTPEPGEKWYQVGIISWGKSCGEKNTPGIYTSLVNYNLWIEK 297

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 77/237 (32%)
Tryp_SPc 28..257 CDD:238113 79/240 (33%)
PRSS55NP_940866.2 Tryp_SPc 67..295 CDD:214473 77/237 (32%)
Tryp_SPc 68..298 CDD:238113 79/240 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 308..330
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.