DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment etaTry and Prtn3

DIOPT Version :9

Sequence 1:NP_523692.1 Gene:etaTry / 36217 FlyBaseID:FBgn0011554 Length:262 Species:Drosophila melanogaster
Sequence 2:NP_035308.2 Gene:Prtn3 / 19152 MGIID:893580 Length:254 Species:Mus musculus


Alignment Length:261 Identity:62/261 - (23%)
Similarity:98/261 - (37%) Gaps:51/261 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 LLGIYAVSAQSDGRIVGGADTSSYYTKYVVQLRRRSSSSSSYAQTCGGCILDAVTIATAAHCVYN 78
            ||.:....|....:||||.:...:...||..|:......|.:   |||.::....:.|||||:.:
Mouse    16 LLALVVGGAVQASKIVGGHEARPHSRPYVASLQLSRFPGSHF---CGGTLIHPRFVLTAAHCLQD 77

  Fly    79 REAENFLVVAGDDSRGGMNGVVVRVSKLIPHEL-------------------YNSSTMDNDIALV 124
            ...:...||.|                  .|:|                   ||.....||:.|:
Mouse    78 ISWQLVTVVLG------------------AHDLLSSEPEQQKFTISQVFQNNYNPEENLNDVLLL 124

  Fly   125 VVDPPLPLDSFSTMEAIEIASEQPAVGVQATISGWGYTKENGLSSDQLQQVKVPIVDSEKCQEAY 189
            .::....|.....:.::....:..:.|.|....|||.......:...||::.|.:| :..|:   
Mouse   125 QLNRTASLGKEVAVASLPQQDQTLSQGTQCLAMGWGRLGTQAPTPRVLQELNVTVV-TFLCR--- 185

  Fly   190 YWRPISEGMLCAGLSEGGKDACQGDSGGPLVVANKLAGIVSWG-EGCARPNYPGVYANVAYYKDW 253
                  |..:|..:.......|.|||||||:....|.|:.|:. ..||...:|..:|.|:.|.||
Mouse   186 ------EHNVCTLVPRRAAGICFGDSGGPLICNGILHGVDSFVIRECASLQFPDFFARVSMYVDW 244

  Fly   254 I 254
            |
Mouse   245 I 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
etaTryNP_523692.1 Tryp_SPc 27..254 CDD:214473 57/246 (23%)
Tryp_SPc 28..257 CDD:238113 59/247 (24%)
Prtn3NP_035308.2 Tryp_SPc 29..245 CDD:214473 57/246 (23%)
Tryp_SPc 30..248 CDD:238113 59/247 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D469244at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.